SCOPe 2.05: Domain d4jgyc_: 4jgy C:

Lineage for d4jgyc_ (4jgy C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.0: automated matches [191569] (1 protein)
   not a true family

6. Protein automated matches [190988] (10 species)
   not a true protein

7. Species Human coxsackievirus a16 [TaxId:31704] [256333] (2 PDB entries)

8. Domain d4jgyc_: 4jgy C: [252940]
   automated match to d1cov3_

Details for d4jgyc_

PDB Entry: 4jgy, 3 Å

PDB Description: Crystal structure of human coxsackievirus A16 uncoating intermediate (space group P4232)

PDB Compounds: (C:) Polyprotein, capsid protein VP3

SCOPe Domain Sequences for d4jgyc_:

Sequence, based on SEQRES records:

>d4jgyc_ b.121.4.0 (C:) automated matches {Human coxsackievirus a16 [TaxId: 31704]}
giptelkpgtnqflttddgvsapilpgfhptppihipgevhnlleicrvetilevnnlkt
nettpmqrlcfpvsvqsktgelcaafradpgrdgpwqstilgqlcryytqwsgslevtfm
fagsfmatgkmliaytppggnvpadritamlgthviwdfglqssvtlvvpwisnthyrah
aragyfdyyttgiitiwyqtnyvvpigapttayivalaaaqdnftmklckdtedie

Sequence, based on observed residues (ATOM records):

>d4jgyc_ b.121.4.0 (C:) automated matches {Human coxsackievirus a16 [TaxId: 31704]}
giptelkpgtnqflttddgvsapilpgfhptppihipgevhnlleicrvetilevnnlkt
nettpmqrlcfpvsvqsktgelcaafradpgrdgpwqstilgqlcryytqwsgslevtfm
fagsfmatgkmliaytppggnvpadritamlgthviwdfglqssvtlvvpwisnthyray
fdyyttgiitiwyqtnyvvpigapttayivalaaaqdnftmklckdtedie

Timeline for d4jgyc_:

• d4jgyc_ first appeared in SCOPe 2.04
  
• d4jgyc_ appears in SCOPe 2.06
  
• d4jgyc_ appears in the current release, SCOPe 2.08