Lineage for d1eygc_ (1eyg C:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 799407Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) (S)
  5. 799474Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (12 proteins)
    barrel, closed; n=5, S=10
  6. 799579Protein ssDNA-binding protein [50264] (4 species)
  7. 799582Species Escherichia coli [TaxId:562] [50266] (5 PDB entries)
    Uniprot P02339
  8. 799589Domain d1eygc_: 1eyg C: [25294]

Details for d1eygc_

PDB Entry: 1eyg (more details), 2.8 Å

PDB Description: Crystal structure of chymotryptic fragment of E. coli ssb bound to two 35-mer single strand DNAS
PDB Compounds: (C:) single-strand DNA-binding protein

SCOP Domain Sequences for d1eygc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eygc_ b.40.4.3 (C:) ssDNA-binding protein {Escherichia coli [TaxId: 562]}
asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqml

SCOP Domain Coordinates for d1eygc_:

Click to download the PDB-style file with coordinates for d1eygc_.
(The format of our PDB-style files is described here.)

Timeline for d1eygc_: