Lineage for d1eygc_ (1eyg C:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373898Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 374537Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) (S)
  5. 374604Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (10 proteins)
    barrel, closed; n=5, S=10
  6. 374676Protein ssDNA-binding protein [50264] (3 species)
  7. 374677Species Escherichia coli [TaxId:562] [50266] (4 PDB entries)
  8. 374684Domain d1eygc_: 1eyg C: [25294]

Details for d1eygc_

PDB Entry: 1eyg (more details), 2.8 Å

PDB Description: Crystal structure of chymotryptic fragment of E. coli ssb bound to two 35-mer single strand DNAS

SCOP Domain Sequences for d1eygc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eygc_ b.40.4.3 (C:) ssDNA-binding protein {Escherichia coli}
asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqml

SCOP Domain Coordinates for d1eygc_:

Click to download the PDB-style file with coordinates for d1eygc_.
(The format of our PDB-style files is described here.)

Timeline for d1eygc_: