Lineage for d1eygc_ (1eyg C:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 14052Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 14109Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (6 proteins)
  6. 14130Protein ssDNA-binding protein [50264] (2 species)
  7. 14131Species Escherichia coli [TaxId:562] [50266] (3 PDB entries)
  8. 14142Domain d1eygc_: 1eyg C: [25294]

Details for d1eygc_

PDB Entry: 1eyg (more details), 2.8 Å

PDB Description: Crystal structure of chymotryptic fragment of E. coli ssb bound to two 35-mer single strand DNAS

SCOP Domain Sequences for d1eygc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eygc_ b.40.4.3 (C:) ssDNA-binding protein {Escherichia coli}
asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqml

SCOP Domain Coordinates for d1eygc_:

Click to download the PDB-style file with coordinates for d1eygc_.
(The format of our PDB-style files is described here.)

Timeline for d1eygc_: