Lineage for d4jgva_ (4jgv A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2335124Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2335522Protein Orphan nuclear receptor NR4A1 [158811] (1 species)
  7. 2335523Species Human (Homo sapiens) [TaxId:9606] [158812] (15 PDB entries)
    Uniprot P22736 363-595
  8. 2335550Domain d4jgva_: 4jgv A: [252937]
    automated match to d3v3ea_
    complexed with gol, t94

Details for d4jgva_

PDB Entry: 4jgv (more details), 3.01 Å

PDB Description: Crystal Structure of Human Nur77 Ligand-binding Domain in Complex with THPN
PDB Compounds: (A:) Nuclear receptor subfamily 4 group A member 1

SCOPe Domain Sequences for d4jgva_:

Sequence, based on SEQRES records: (download)

>d4jgva_ a.123.1.1 (A:) Orphan nuclear receptor NR4A1 {Human (Homo sapiens) [TaxId: 9606]}
anlltslvrahldsgpstakldyskfqelvlphfgkedagdvqqfydllsgslevirkwa
ekipgfaelspadqdlllesaflelfilrlayrskpgegklifcsglvlhrlqcargfgd
widsilafsrslhsllvdvpafaclsalvlitdrhglqeprrveelqnriasclkehvaa
vagepqpasclsrllgklpelrtlctqglqrifylkledlvppppiidkifmdtlpf

Sequence, based on observed residues (ATOM records): (download)

>d4jgva_ a.123.1.1 (A:) Orphan nuclear receptor NR4A1 {Human (Homo sapiens) [TaxId: 9606]}
anlltslvrahldsgpstakldyskfqelvlphfgkedagdvqqfydllsgslevirkwa
ekipgfaelspadqdlllesaflelfilrlayrskpgegklifcsglvlhrlqcargfgd
widsilafsrslhsllvdvpafaclsalvlitdrhglqeprrveelqnriasclkehvaa
vaeppalsrllgklpelrtlctqglqrifylkledlvppppiidkifmdtlpf

SCOPe Domain Coordinates for d4jgva_:

Click to download the PDB-style file with coordinates for d4jgva_.
(The format of our PDB-style files is described here.)

Timeline for d4jgva_: