SCOPe 2.04: Domain d4jgga_: 4jgg A:

Lineage for d4jgga_ (4jgg A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.10: SGNH hydrolase [52266] (10 families)

5. Family c.23.10.0: automated matches [191588] (1 protein)
   not a true family

6. Protein automated matches [191059] (10 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [256330] (1 PDB entry)

8. Domain d4jgga_: 4jgg A: [252929]
   automated match to d3hp4a_

Details for d4jgga_

PDB Entry: 4jgg, 1.9 Å

PDB Description: Crystal Structure of TesA

PDB Compounds: (A:) Esterase TesA

SCOPe Domain Sequences for d4jgga_:

Sequence; same for both SEQRES and ATOM records:

>d4jgga_ c.23.10.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
qtllvvgdsisaalgldtsqgwvallqkrladegydyrvvnasisgdtsagglarlpall
aeekpalvvielggndglrgmapaqlqqnlasmaqkaraegakvlllgiqlppnygpryi
eafsrvygavaaqektalvpfflegvggvqgmmqadgihpalaaqprllenvwptlkpll

Timeline for d4jgga_:

• d4jgga_ is new in SCOPe 2.04-stable
  
• d4jgga_ appears in SCOPe 2.05
  
• d4jgga_ appears in the current release, SCOPe 2.08