Lineage for d4jgga_ (4jgg A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857378Superfamily c.23.10: SGNH hydrolase [52266] (10 families) (S)
  5. 2857506Family c.23.10.0: automated matches [191588] (1 protein)
    not a true family
  6. 2857507Protein automated matches [191059] (16 species)
    not a true protein
  7. 2857569Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [256330] (1 PDB entry)
  8. 2857570Domain d4jgga_: 4jgg A: [252929]
    automated match to d3hp4a_

Details for d4jgga_

PDB Entry: 4jgg (more details), 1.9 Å

PDB Description: Crystal Structure of TesA
PDB Compounds: (A:) Esterase TesA

SCOPe Domain Sequences for d4jgga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jgga_ c.23.10.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
qtllvvgdsisaalgldtsqgwvallqkrladegydyrvvnasisgdtsagglarlpall
aeekpalvvielggndglrgmapaqlqqnlasmaqkaraegakvlllgiqlppnygpryi
eafsrvygavaaqektalvpfflegvggvqgmmqadgihpalaaqprllenvwptlkpll

SCOPe Domain Coordinates for d4jgga_:

Click to download the PDB-style file with coordinates for d4jgga_.
(The format of our PDB-style files is described here.)

Timeline for d4jgga_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4jggb_