Lineage for d4jf0b_ (4jf0 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132878Species Salmonella typhimurium [TaxId:99287] [255544] (9 PDB entries)
  8. 2132896Domain d4jf0b_: 4jf0 B: [252917]
    automated match to d4adbb_
    complexed with act, edo, na; mutant

Details for d4jf0b_

PDB Entry: 4jf0 (more details), 2.1 Å

PDB Description: n79r mutant of n-acetylornithine aminotransferase
PDB Compounds: (B:) Acetylornithine/succinyldiaminopimelate aminotransferase

SCOPe Domain Sequences for d4jf0b_:

Sequence, based on SEQRES records: (download)

>d4jf0b_ c.67.1.0 (B:) automated matches {Salmonella typhimurium [TaxId: 99287]}
lpvyapadfipvkgkgsrvwdqqgkeyidfaggiavtalghchpalvealksqgetlwht
srvftnepalrlgrklidatfaervlfmnsgteanetafklarhyacvrhspfktkiiaf
hnafhgrslftvsvggqpkysdgfgpkpadiihvpfndlhavkavmddhtcavvvepiqg
eggvqaatpeflkglrdlcdehqallvfdevqcgmgrtgdlfaymhygvtpdiltsakal
gggfpvsamlttqeiasafhvgshgstyggnplacavagatfdiintpevlqgihtkrqq
fvqhlqaideqfdifsdirgmglligaelkpkykgrardflyagaeagvmvlnagadvmr
fapslvveeadihegmqrfaqavgkvva

Sequence, based on observed residues (ATOM records): (download)

>d4jf0b_ c.67.1.0 (B:) automated matches {Salmonella typhimurium [TaxId: 99287]}
lpvyapadfipvkgkgsrvwdqqgkeyidfaggiavtalghchpalvealksqgetlwht
srvftnepalrlgrklidatfaervlfmnsgteanetafklarhyacvrhspfktkiiaf
hnafhgrslftvsvggqpkysdgfgpkpadiihvpfndlhavkavmddhtcavvvepiqg
eggvqaatpeflkglrdlcdehqallvfdevqcgmgrtgdlfaymhygvtpdiltsakal
gggfpvsamlttqeiasafgstyggnplacavagatfdiintpevlqgihtkrqqfvqhl
qaideqfdifsdirgmglligaelkpkykgrardflyagaeagvmvlnagadvmrfapsl
vveeadihegmqrfaqavgkvva

SCOPe Domain Coordinates for d4jf0b_:

Click to download the PDB-style file with coordinates for d4jf0b_.
(The format of our PDB-style files is described here.)

Timeline for d4jf0b_: