Lineage for d4jeyb_ (4jey B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2505487Species Salmonella typhimurium [TaxId:99287] [255544] (9 PDB entries)
  8. 2505497Domain d4jeyb_: 4jey B: [252913]
    Other proteins in same PDB: d4jeya2
    automated match to d4adbc_
    complexed with act, edo, na, plp; mutant

Details for d4jeyb_

PDB Entry: 4jey (more details), 1.55 Å

PDB Description: E198A mutant of N-acetylornithine aminotransferase from Salmonella typhimurium
PDB Compounds: (B:) Acetylornithine/succinyldiaminopimelate aminotransferase

SCOPe Domain Sequences for d4jeyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jeyb_ c.67.1.0 (B:) automated matches {Salmonella typhimurium [TaxId: 99287]}
lpvyapadfipvkgkgsrvwdqqgkeyidfaggiavtalghchpalvealksqgetlwht
snvftnepalrlgrklidatfaervlfmnsgteanetafklarhyacvrhspfktkiiaf
hnafhgrslftvsvggqpkysdgfgpkpadiihvpfndlhavkavmddhtcavvvepiqg
aggvqaatpeflkglrdlcdehqallvfdevqcgmgrtgdlfaymhygvtpdiltsakal
gggfpvsamlttqeiasafhvgshgstyggnplacavagatfdiintpevlqgihtkrqq
fvqhlqaideqfdifsdirgmglligaelkpkykgrardflyagaeagvmvlnagadvmr
fapslvveeadihegmqrfaqavgkvva

SCOPe Domain Coordinates for d4jeyb_:

Click to download the PDB-style file with coordinates for d4jeyb_.
(The format of our PDB-style files is described here.)

Timeline for d4jeyb_: