SCOPe 2.08: Domain d4jewb_: 4jew B:

Lineage for d4jewb_ (4jew B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (166 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:99287] [255544] (9 PDB entries)

8. Domain d4jewb_: 4jew B: [252909]
   Other proteins in same PDB: d4jewa2
   automated match to d4adbb_
   complexed with act, edo, p00, tnf

Details for d4jewb_

PDB Entry: 4jew, 1.48 Å

PDB Description: N-acetylornithine aminotransferase from S. typhimurium complexed with L-canaline

PDB Compounds: (B:) Acetylornithine/succinyldiaminopimelate aminotransferase

SCOPe Domain Sequences for d4jewb_:

Sequence; same for both SEQRES and ATOM records:

>d4jewb_ c.67.1.0 (B:) automated matches {Salmonella typhimurium [TaxId: 99287]}
vilpvyapadfipvkgkgsrvwdqqgkeyidfaggiavtalghchpalvealksqgetlw
htsnvftnepalrlgrklidatfaervlfmnsgteanetafklarhyacvrhspfktkii
afhnafhgrslftvsvggqpkysdgfgpkpadiihvpfndlhavkavmddhtcavvvepi
qgeggvqaatpeflkglrdlcdehqallvfdevqcgmgrtgdlfaymhygvtpdiltsak
algggfpvsamlttqeiasafhvgshgstyggnplacavagatfdiintpevlqgihtkr
qqfvqhlqaideqfdifsdirgmglligaelkpkykgrardflyagaeagvmvlnagadv
mrfapslvveeadihegmqrfaqavgkvv

Timeline for d4jewb_:

• d4jewb_ first appeared in SCOPe 2.04
  
• d4jewb_ appears in SCOPe 2.07