| Class b: All beta proteins [48724] (176 folds) |
| Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) ![]() |
| Family b.3.1.0: automated matches [254199] (1 protein) not a true family |
| Protein automated matches [254436] (4 species) not a true protein |
| Species Bacillus clarkii [TaxId:79879] [256325] (1 PDB entry) |
| Domain d4jcma4: 4jcm A:569-674 [252889] Other proteins in same PDB: d4jcma1, d4jcma2, d4jcma3 automated match to d1cyga2 complexed with ca, cl, edo, gol, na, so4 |
PDB Entry: 4jcm (more details), 1.65 Å
SCOPe Domain Sequences for d4jcma4:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jcma4 b.3.1.0 (A:569-674) automated matches {Bacillus clarkii [TaxId: 79879]}
ltgkqesvrfvvdnahtnygenvylvgnvpelgnwnpadaigpmfnqvvysyptwyydvs
vpadtalefkfiivdgngnvtwesggnhnyrvtsgstdtvrvsfrr
Timeline for d4jcma4: