![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (81 species) not a true protein |
![]() | Species Paenibacillus macerans [TaxId:44252] [256324] (4 PDB entries) |
![]() | Domain d4jcla3: 4jcl A:498-584 [252884] Other proteins in same PDB: d4jcla1, d4jcla2, d4jcla4 automated match to d3cgta1 complexed with ca, cl, edo, gol, peg, pge |
PDB Entry: 4jcl (more details), 1.7 Å
SCOPe Domain Sequences for d4jcla3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jcla3 b.1.18.0 (A:498-584) automated matches {Paenibacillus macerans [TaxId: 44252]} tspaignvgptmgqpgnivtidgrgfggtagtvyfgttavtgsgivswedtqikavipkv aagktgvsvktssgtasntfksfnvlt
Timeline for d4jcla3: