Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) same topology as (b.1.15.1) |
Family b.1.30.0: automated matches [254306] (1 protein) not a true family |
Protein automated matches [254707] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255965] (11 PDB entries) |
Domain d4jbsb3: 4jbs B:547-637 [252878] Other proteins in same PDB: d4jbsa1, d4jbsa2, d4jbsa4, d4jbsb1, d4jbsb2, d4jbsb4 automated match to d2yd0a3 complexed with imd, nag, p52, zn |
PDB Entry: 4jbs (more details), 2.79 Å
SCOPe Domain Sequences for d4jbsb3:
Sequence, based on SEQRES records: (download)
>d4jbsb3 b.1.30.0 (B:547-637) automated matches {Human (Homo sapiens) [TaxId: 9606]} ipllvvkqdgcslrlqqerflqgvfqedpewralqerylwhipltystsssnvihrhilk sktdtldlpektswvkfnvdsngyyivhyeg
>d4jbsb3 b.1.30.0 (B:547-637) automated matches {Human (Homo sapiens) [TaxId: 9606]} iplldgcslrlqqerflqgverylwhiplttsssnvihrhilksktdtldlpektswvkf nvdsngyyivhyeg
Timeline for d4jbsb3:
View in 3D Domains from other chains: (mouse over for more information) d4jbsa1, d4jbsa2, d4jbsa3, d4jbsa4 |