Lineage for d4jbsb3 (4jbs B:547-637)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766973Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. 2766995Family b.1.30.0: automated matches [254306] (1 protein)
    not a true family
  6. 2766996Protein automated matches [254707] (4 species)
    not a true protein
  7. 2766997Species Human (Homo sapiens) [TaxId:9606] [255965] (22 PDB entries)
  8. 2767021Domain d4jbsb3: 4jbs B:547-637 [252878]
    Other proteins in same PDB: d4jbsa1, d4jbsa2, d4jbsa4, d4jbsa5, d4jbsb1, d4jbsb2, d4jbsb4, d4jbsb5
    automated match to d2yd0a3
    complexed with imd, nag, p52, zn

Details for d4jbsb3

PDB Entry: 4jbs (more details), 2.79 Å

PDB Description: crystal structure of the human endoplasmic reticulum aminopeptidase 2 in complex with phosphinic pseudotripeptide inhibitor.
PDB Compounds: (B:) Endoplasmic reticulum aminopeptidase 2

SCOPe Domain Sequences for d4jbsb3:

Sequence, based on SEQRES records: (download)

>d4jbsb3 b.1.30.0 (B:547-637) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ipllvvkqdgcslrlqqerflqgvfqedpewralqerylwhipltystsssnvihrhilk
sktdtldlpektswvkfnvdsngyyivhyeg

Sequence, based on observed residues (ATOM records): (download)

>d4jbsb3 b.1.30.0 (B:547-637) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iplldgcslrlqqerflqgverylwhiplttsssnvihrhilksktdtldlpektswvkf
nvdsngyyivhyeg

SCOPe Domain Coordinates for d4jbsb3:

Click to download the PDB-style file with coordinates for d4jbsb3.
(The format of our PDB-style files is described here.)

Timeline for d4jbsb3: