![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) ![]() same topology as (b.1.15.1) |
![]() | Family b.1.30.0: automated matches [254306] (1 protein) not a true family |
![]() | Protein automated matches [254707] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255965] (22 PDB entries) |
![]() | Domain d4jbsb3: 4jbs B:547-637 [252878] Other proteins in same PDB: d4jbsa1, d4jbsa2, d4jbsa4, d4jbsa5, d4jbsb1, d4jbsb2, d4jbsb4, d4jbsb5 automated match to d2yd0a3 complexed with imd, nag, p52, zn |
PDB Entry: 4jbs (more details), 2.79 Å
SCOPe Domain Sequences for d4jbsb3:
Sequence, based on SEQRES records: (download)
>d4jbsb3 b.1.30.0 (B:547-637) automated matches {Human (Homo sapiens) [TaxId: 9606]} ipllvvkqdgcslrlqqerflqgvfqedpewralqerylwhipltystsssnvihrhilk sktdtldlpektswvkfnvdsngyyivhyeg
>d4jbsb3 b.1.30.0 (B:547-637) automated matches {Human (Homo sapiens) [TaxId: 9606]} iplldgcslrlqqerflqgverylwhiplttsssnvihrhilksktdtldlpektswvkf nvdsngyyivhyeg
Timeline for d4jbsb3: