Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
Protein automated matches [190805] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188286] (36 PDB entries) |
Domain d4jbsb2: 4jbs B:272-546 [252877] Other proteins in same PDB: d4jbsa1, d4jbsa3, d4jbsa4, d4jbsb1, d4jbsb3, d4jbsb4 automated match to d2yd0a2 complexed with imd, nag, p52, zn |
PDB Entry: 4jbs (more details), 2.79 Å
SCOPe Domain Sequences for d4jbsb2:
Sequence, based on SEQRES records: (download)
>d4jbsb2 d.92.1.0 (B:272-546) automated matches {Human (Homo sapiens) [TaxId: 9606]} hslsgftssgvkvsiyaspdkrnqthyalqaslklldfyekyfdiyyplskldliaipdf apgamenwglityretsllfdpktssasdklwvtrviahelahqwfgnlvtmewwndiwl kegfakymeliavnatypelqfddyflnvcfevitkdslnssrpiskpaetptqiqemfd evsynkgacilnmlkdflgeekfqkgiiqylkkfsyrnaknddlwsslsnsclesdftsg gvchsdpkmtsnmlaflgenaevkemmttwtlqkg
>d4jbsb2 d.92.1.0 (B:272-546) automated matches {Human (Homo sapiens) [TaxId: 9606]} hslsgftssgvkvsiyaspdkrnqthyalqaslklldfyekyfdiyyplskldliaipdf apgamenwglityretsllfdpktssasdklwvtrviahelahqwfgnlvtmewwndiwl kegfakymeliavnatypelqfddyflnvcfevitkdslnssrpiskpaetptqiqemfd evsynkgacilnmlkdflgeekfqkgiiqylkkfsyrnaknddlwsslsnsaevkemmtt wtlqkg
Timeline for d4jbsb2:
View in 3D Domains from other chains: (mouse over for more information) d4jbsa1, d4jbsa2, d4jbsa3, d4jbsa4 |