Lineage for d4jbsb2 (4jbs B:272-546)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2530179Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2530180Protein automated matches [190805] (17 species)
    not a true protein
  7. 2530208Species Human (Homo sapiens) [TaxId:9606] [188286] (57 PDB entries)
  8. 2530280Domain d4jbsb2: 4jbs B:272-546 [252877]
    Other proteins in same PDB: d4jbsa1, d4jbsa3, d4jbsa4, d4jbsa5, d4jbsb1, d4jbsb3, d4jbsb4, d4jbsb5
    automated match to d2yd0a2
    complexed with imd, man, nag, p52, zn

Details for d4jbsb2

PDB Entry: 4jbs (more details), 2.79 Å

PDB Description: crystal structure of the human endoplasmic reticulum aminopeptidase 2 in complex with phosphinic pseudotripeptide inhibitor.
PDB Compounds: (B:) Endoplasmic reticulum aminopeptidase 2

SCOPe Domain Sequences for d4jbsb2:

Sequence, based on SEQRES records: (download)

>d4jbsb2 d.92.1.0 (B:272-546) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hslsgftssgvkvsiyaspdkrnqthyalqaslklldfyekyfdiyyplskldliaipdf
apgamenwglityretsllfdpktssasdklwvtrviahelahqwfgnlvtmewwndiwl
kegfakymeliavnatypelqfddyflnvcfevitkdslnssrpiskpaetptqiqemfd
evsynkgacilnmlkdflgeekfqkgiiqylkkfsyrnaknddlwsslsnsclesdftsg
gvchsdpkmtsnmlaflgenaevkemmttwtlqkg

Sequence, based on observed residues (ATOM records): (download)

>d4jbsb2 d.92.1.0 (B:272-546) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hslsgftssgvkvsiyaspdkrnqthyalqaslklldfyekyfdiyyplskldliaipdf
apgamenwglityretsllfdpktssasdklwvtrviahelahqwfgnlvtmewwndiwl
kegfakymeliavnatypelqfddyflnvcfevitkdslnssrpiskpaetptqiqemfd
evsynkgacilnmlkdflgeekfqkgiiqylkkfsyrnaknddlwsslsnsaevkemmtt
wtlqkg

SCOPe Domain Coordinates for d4jbsb2:

Click to download the PDB-style file with coordinates for d4jbsb2.
(The format of our PDB-style files is described here.)

Timeline for d4jbsb2: