SCOPe 2.08: Domain d4jbsb1: 4jbs B:55-271

Lineage for d4jbsb1 (4jbs B:55-271)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
   duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain

4. Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families)

5. Family b.98.1.0: automated matches [254305] (1 protein)
   not a true family

6. Protein automated matches [254706] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255964] (28 PDB entries)

8. Domain d4jbsb1: 4jbs B:55-271 [252876]
   Other proteins in same PDB: d4jbsa2, d4jbsa3, d4jbsa4, d4jbsa5, d4jbsb2, d4jbsb3, d4jbsb4, d4jbsb5
   automated match to d2yd0a1
   complexed with imd, nag, p52, zn

Details for d4jbsb1

PDB Entry: 4jbs, 2.79 Å

PDB Description: crystal structure of the human endoplasmic reticulum aminopeptidase 2 in complex with phosphinic pseudotripeptide inhibitor.

PDB Compounds: (B:) Endoplasmic reticulum aminopeptidase 2

SCOPe Domain Sequences for d4jbsb1:

Sequence, based on SEQRES records:

>d4jbsb1 b.98.1.0 (B:55-271) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vatngerfpwqelrlpsvviplhydlfvhpnltsldfvasekievlvsnatqfiilhskd
leitnatlqseedsrymkpgkelkvlsypaheqiallvpekltphlkyyvamdfqaklgd
gfegfykstyrtlggetrilavtdfeptqarmafpcfdeplfkanfsikirresrhials
nmpkvktielegglledhfettvkmstylvayivcdf

Sequence, based on observed residues (ATOM records):

>d4jbsb1 b.98.1.0 (B:55-271) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vatngerfpwqelrlpsvviplhydlfvhpnltsldfvasekievlvsnatqfiilhskd
leitnatlqsepgkelkvlsypaheqiallvpekltphlkyyvamdfqaklgdgfegfyk
styrtlggetrilavtdfeptqarmafpcfdeplfkanfsikirresrhialsnmpkvkt
ielegglledhfettvkmstylvayivcdf

Timeline for d4jbsb1:

• d4jbsb1 first appeared in SCOPe 2.04
  
• d4jbsb1 appears in SCOPe 2.07