Lineage for d4jbsa4 (4jbs A:638-960)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2726072Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2726073Protein automated matches [190220] (14 species)
    not a true protein
  7. 2726099Species Human (Homo sapiens) [TaxId:9606] [189070] (63 PDB entries)
  8. 2726153Domain d4jbsa4: 4jbs A:638-960 [252875]
    Other proteins in same PDB: d4jbsa1, d4jbsa2, d4jbsa3, d4jbsa5, d4jbsb1, d4jbsb2, d4jbsb3, d4jbsb5
    automated match to d2yd0a4
    complexed with imd, nag, p52, zn

Details for d4jbsa4

PDB Entry: 4jbs (more details), 2.79 Å

PDB Description: crystal structure of the human endoplasmic reticulum aminopeptidase 2 in complex with phosphinic pseudotripeptide inhibitor.
PDB Compounds: (A:) Endoplasmic reticulum aminopeptidase 2

SCOPe Domain Sequences for d4jbsa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jbsa4 a.118.1.0 (A:638-960) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hgwdqlitqlnqnhtllrpkdrvglihdvfqlvgagrltldkaldmtyylqhetsspall
eglsylesfyhmmdrrnisdisenlkryllqyfkpvidrqswsdkgsvwdrmlrsallkl
acdlnhapciqkaaelfsqwmessgklniptdvlkivysvgaqttagwnylleqyelsms
saeqnkilyalstskhqekllklielgmegkviktqnlaallhaiarrpkgqqlawdfvr
enwthllkkfdlgsydirmiisgttahfsskdklqevklffesleaqgshldifqtvlet
itknikwleknlptlrtwlmvnt

SCOPe Domain Coordinates for d4jbsa4:

Click to download the PDB-style file with coordinates for d4jbsa4.
(The format of our PDB-style files is described here.)

Timeline for d4jbsa4: