Lineage for d4jbkb1 (4jbk B:3-112)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2400927Superfamily b.40.16: HIN-2000 domain-like [159141] (2 families) (S)
    duplication: tandem repeat of two OB-fold domains
  5. 2400959Family b.40.16.0: automated matches [233467] (1 protein)
    not a true family
  6. 2400960Protein automated matches [233468] (3 species)
    not a true protein
  7. 2400974Species Mouse (Mus musculus) [TaxId:10090] [234954] (5 PDB entries)
  8. 2400989Domain d4jbkb1: 4jbk B:3-112 [252866]
    automated match to d2oq0d2
    protein/DNA complex

Details for d4jbkb1

PDB Entry: 4jbk (more details), 2.96 Å

PDB Description: Molecular basis for abrogation of activation of pro-inflammatory cytokines
PDB Compounds: (B:) Interferon-activable protein 202

SCOPe Domain Sequences for d4jbkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jbkb1 b.40.16.0 (B:3-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tpkkniskgavlhekpmtvmvltatepfnykegkenmfhatvatesqyyrvkvfnmdlke
kftenkfitiskyfnssgileinetatvseaapnqmfevpkniirsaket

SCOPe Domain Coordinates for d4jbkb1:

Click to download the PDB-style file with coordinates for d4jbkb1.
(The format of our PDB-style files is described here.)

Timeline for d4jbkb1: