SCOPe 2.07: Domain d4jbkb1: 4jbk B:3-112

Lineage for d4jbkb1 (4jbk B:3-112)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.16: HIN-2000 domain-like [159141] (2 families)
   duplication: tandem repeat of two OB-fold domains

5. Family b.40.16.0: automated matches [233467] (1 protein)
   not a true family

6. Protein automated matches [233468] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [234954] (5 PDB entries)

8. Domain d4jbkb1: 4jbk B:3-112 [252866]
   automated match to d2oq0d2
   protein/DNA complex

Details for d4jbkb1

PDB Entry: 4jbk, 2.96 Å

PDB Description: Molecular basis for abrogation of activation of pro-inflammatory cytokines

PDB Compounds: (B:) Interferon-activable protein 202

SCOPe Domain Sequences for d4jbkb1:

Sequence; same for both SEQRES and ATOM records:

>d4jbkb1 b.40.16.0 (B:3-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tpkkniskgavlhekpmtvmvltatepfnykegkenmfhatvatesqyyrvkvfnmdlke
kftenkfitiskyfnssgileinetatvseaapnqmfevpkniirsaket

Timeline for d4jbkb1:

• d4jbkb1 first appeared in SCOPe 2.04
  
• d4jbkb1 appears in SCOPe 2.06
  
• d4jbkb1 appears in the current release, SCOPe 2.08