Lineage for d4jbka2 (4jbk A:113-199)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1542821Superfamily b.40.16: HIN-2000 domain-like [159141] (2 families) (S)
    duplication: tandem repeat of two OB-fold domains
  5. 1542849Family b.40.16.0: automated matches [233467] (1 protein)
    not a true family
  6. 1542850Protein automated matches [233468] (2 species)
    not a true protein
  7. 1542864Species Mouse (Mus musculus) [TaxId:10090] [234954] (4 PDB entries)
  8. 1542876Domain d4jbka2: 4jbk A:113-199 [252865]
    automated match to d2oq0a1
    protein/DNA complex

Details for d4jbka2

PDB Entry: 4jbk (more details), 2.96 Å

PDB Description: Molecular basis for abrogation of activation of pro-inflammatory cytokines
PDB Compounds: (A:) Interferon-activable protein 202

SCOPe Domain Sequences for d4jbka2:

Sequence, based on SEQRES records: (download)

>d4jbka2 b.40.16.0 (A:113-199) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lkiskikeldsgtliygvfavekkkvndksitfkikdnednikvvwdkeqhninyekgdk
lqlfsfhlrkgngkpilhsgnhsfikg

Sequence, based on observed residues (ATOM records): (download)

>d4jbka2 b.40.16.0 (A:113-199) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lkiskikeldsgtliygvfavekkkvndksitfkikdnednikvvwdkeqhninklqlfs
fhlrkgngkpilhsgnhsfikg

SCOPe Domain Coordinates for d4jbka2:

Click to download the PDB-style file with coordinates for d4jbka2.
(The format of our PDB-style files is described here.)

Timeline for d4jbka2: