| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
| Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
| Protein automated matches [190131] (86 species) not a true protein |
| Species Thermotoga maritima [TaxId:2336] [188956] (20 PDB entries) |
| Domain d4javc_: 4jav C: [252858] Other proteins in same PDB: d4java1, d4java2, d4javb1, d4javb2 automated match to d3dgec_ complexed with adp, cl, mg, so4; mutant |
PDB Entry: 4jav (more details), 3.1 Å
SCOPe Domain Sequences for d4javc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4javc_ c.23.1.0 (C:) automated matches {Thermotoga maritima [TaxId: 2336]}
skkvllvddsapirkmvsfvlkkegyevieaengqialeklseftpdlivldimmpvmdg
ftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhlln
e
Timeline for d4javc_: