Lineage for d4javb2 (4jav B:321-479)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1667394Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1667395Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 1667798Family d.122.1.3: Histidine kinase [55884] (8 proteins)
  6. 1667845Protein automated matches [190839] (4 species)
    not a true protein
  7. 1667859Species Thermotoga maritima [TaxId:243274] [227717] (3 PDB entries)
  8. 1667862Domain d4javb2: 4jav B:321-479 [252857]
    Other proteins in same PDB: d4java1, d4javb1, d4javc_, d4javd_
    automated match to d2c2aa2
    complexed with adp, cl, mg, so4; mutant

Details for d4javb2

PDB Entry: 4jav (more details), 3.1 Å

PDB Description: Structural basis of a rationally rewired protein-protein interface (HK853wt and RR468mutant V13P, L14I, I17M and N21V)
PDB Compounds: (B:) Histidine kinase

SCOPe Domain Sequences for d4javb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4javb2 d.122.1.3 (B:321-479) automated matches {Thermotoga maritima [TaxId: 243274]}
qinrekvdlcdlvesavnaikefasshnvnvlfesnvpcpveayidptrirqvllnllnn
gvkyskkdapdkyvkvildekdggvliivedngigipdhakdrifeqfyrvdssltyevp
gtglglaitkeivelhggriwvesevgkgsrffvwipkd

SCOPe Domain Coordinates for d4javb2:

Click to download the PDB-style file with coordinates for d4javb2.
(The format of our PDB-style files is described here.)

Timeline for d4javb2: