SCOPe 2.08: Domain d4javb2: 4jav B:321-479

Lineage for d4javb2 (4jav B:321-479)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.3: Histidine kinase [55884] (8 proteins)

6. Protein automated matches [190839] (4 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [227717] (6 PDB entries)

8. Domain d4javb2: 4jav B:321-479 [252857]
   Other proteins in same PDB: d4java1, d4javb1, d4javc_, d4javd_
   automated match to d2c2aa2
   complexed with adp, cl, mg, so4; mutant

Details for d4javb2

PDB Entry: 4jav, 3.1 Å

PDB Description: Structural basis of a rationally rewired protein-protein interface (HK853wt and RR468mutant V13P, L14I, I17M and N21V)

PDB Compounds: (B:) Histidine kinase

SCOPe Domain Sequences for d4javb2:

Sequence; same for both SEQRES and ATOM records:

>d4javb2 d.122.1.3 (B:321-479) automated matches {Thermotoga maritima [TaxId: 243274]}
qinrekvdlcdlvesavnaikefasshnvnvlfesnvpcpveayidptrirqvllnllnn
gvkyskkdapdkyvkvildekdggvliivedngigipdhakdrifeqfyrvdssltyevp
gtglglaitkeivelhggriwvesevgkgsrffvwipkd

Timeline for d4javb2:

• d4javb2 first appeared in SCOPe 2.04
  
• d4javb2 appears in SCOPe 2.07