SCOPe 2.07: Domain d4java1: 4jav A:234-320

Lineage for d4java1 (4jav A:234-320)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.30: ROP-like [47379] (8 superfamilies)
   4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist

4. Superfamily a.30.2: Homodimeric domain of signal transducing histidine kinase [47384] (2 families)

5. Family a.30.2.0: automated matches [227712] (1 protein)
   not a true family

6. Protein automated matches [227713] (2 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [227714] (5 PDB entries)

8. Domain d4java1: 4jav A:234-320 [252854]
   Other proteins in same PDB: d4java2, d4javb2, d4javc_, d4javd_
   automated match to d2c2aa1
   complexed with adp, cl, mg, so4; mutant

Details for d4java1

PDB Entry: 4jav, 3.1 Å

PDB Description: Structural basis of a rationally rewired protein-protein interface (HK853wt and RR468mutant V13P, L14I, I17M and N21V)

PDB Compounds: (A:) Histidine kinase

SCOPe Domain Sequences for d4java1:

Sequence; same for both SEQRES and ATOM records:

>d4java1 a.30.2.0 (A:234-320) automated matches {Thermotoga maritima [TaxId: 243274]}
nvteskelerlkridrmktefianishelrtpltaikayaetiynslgeldlstlkefle
viidqsnhlenllnelldfsrlerksl

Timeline for d4java1:

• d4java1 first appeared in SCOPe 2.04
  
• d4java1 appears in SCOPe 2.06