Lineage for d4java1 (4jav A:234-320)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709045Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 2709085Superfamily a.30.2: Homodimeric domain of signal transducing histidine kinase [47384] (2 families) (S)
  5. 2709103Family a.30.2.0: automated matches [227712] (1 protein)
    not a true family
  6. 2709104Protein automated matches [227713] (2 species)
    not a true protein
  7. 2709120Species Thermotoga maritima [TaxId:243274] [227714] (7 PDB entries)
  8. 2709124Domain d4java1: 4jav A:234-320 [252854]
    Other proteins in same PDB: d4java2, d4javb2, d4javc_, d4javd_
    automated match to d2c2aa1
    complexed with adp, cl, mg, so4; mutant

Details for d4java1

PDB Entry: 4jav (more details), 3.1 Å

PDB Description: Structural basis of a rationally rewired protein-protein interface (HK853wt and RR468mutant V13P, L14I, I17M and N21V)
PDB Compounds: (A:) Histidine kinase

SCOPe Domain Sequences for d4java1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4java1 a.30.2.0 (A:234-320) automated matches {Thermotoga maritima [TaxId: 243274]}
nvteskelerlkridrmktefianishelrtpltaikayaetiynslgeldlstlkefle
viidqsnhlenllnelldfsrlerksl

SCOPe Domain Coordinates for d4java1:

Click to download the PDB-style file with coordinates for d4java1.
(The format of our PDB-style files is described here.)

Timeline for d4java1: