Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries) |
Domain d4janl2: 4jan L:106-207 [252850] Other proteins in same PDB: d4janb1, d4janl1 automated match to d1lila2 complexed with gol, na, nag |
PDB Entry: 4jan (more details), 3.15 Å
SCOPe Domain Sequences for d4janl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4janl2 b.1.1.2 (L:106-207) automated matches {Human (Homo sapiens) [TaxId: 9606]} vlrqpkanptvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttp skqsnnkyaassylsltpeqwkshrsyscqvthegstvektva
Timeline for d4janl2: