Lineage for d1qvcb_ (1qvc B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 462779Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 463443Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) (S)
  5. 463510Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (10 proteins)
    barrel, closed; n=5, S=10
  6. 463582Protein ssDNA-binding protein [50264] (4 species)
  7. 463585Species Escherichia coli [TaxId:562] [50266] (5 PDB entries)
  8. 463587Domain d1qvcb_: 1qvc B: [25285]

Details for d1qvcb_

PDB Entry: 1qvc (more details), 2.2 Å

PDB Description: crystal structure analysis of single stranded dna binding protein (ssb) from e.coli

SCOP Domain Sequences for d1qvcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvcb_ b.40.4.3 (B:) ssDNA-binding protein {Escherichia coli}
asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggrqggga
paggnigggqpqggwgqpqqpqgg

SCOP Domain Coordinates for d1qvcb_:

Click to download the PDB-style file with coordinates for d1qvcb_.
(The format of our PDB-style files is described here.)

Timeline for d1qvcb_: