![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.1: SH3-domain [50045] (40 proteins) |
![]() | Protein automated matches [190043] (8 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187799] (38 PDB entries) |
![]() | Domain d4j9fa_: 4j9f A: [252844] automated match to d4jjba_ complexed with gol, so4 |
PDB Entry: 4j9f (more details), 1.09 Å
SCOPe Domain Sequences for d4j9fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j9fa_ b.34.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mendpnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitp vn
Timeline for d4j9fa_: