Lineage for d4j8eb_ (4j8e B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1501447Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 1501668Family a.118.8.0: automated matches [191581] (1 protein)
    not a true family
  6. 1501669Protein automated matches [191037] (10 species)
    not a true protein
  7. 1501694Species Norway rat (Rattus norvegicus) [TaxId:10116] [256317] (1 PDB entry)
  8. 1501695Domain d4j8eb_: 4j8e B: [252843]
    automated match to d2buga1
    complexed with gol

Details for d4j8eb_

PDB Entry: 4j8e (more details), 2.6 Å

PDB Description: Middle domain of Hsc70-interacting protein, crystal form I
PDB Compounds: (B:) Hsc70-interacting protein

SCOPe Domain Sequences for d4j8eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j8eb_ a.118.8.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pqemgdenaeiteammdeanekkgaaidalndgelqkaidlftdaiklnprlailyakra
svfvklqkpnaairdcdraieinpdsaqpykwrgkahrllghweeaardlalackldyd

SCOPe Domain Coordinates for d4j8eb_:

Click to download the PDB-style file with coordinates for d4j8eb_.
(The format of our PDB-style files is described here.)

Timeline for d4j8eb_: