Lineage for d4j7xj_ (4j7x J:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842760Protein Sepiapterin reductase [51767] (2 species)
  7. 2842761Species Human (Homo sapiens) [TaxId:9606] [141874] (14 PDB entries)
    Uniprot P35270 5-261
  8. 2842795Domain d4j7xj_: 4j7x J: [252842]
    automated match to d1z6za1
    complexed with gol, nap, peg, sas, so4

Details for d4j7xj_

PDB Entry: 4j7x (more details), 2.6 Å

PDB Description: Crystal structure of human sepiapterin reductase in complex with sulfasalazine
PDB Compounds: (J:) sepiapterin reductase

SCOPe Domain Sequences for d4j7xj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j7xj_ c.2.1.2 (J:) Sepiapterin reductase {Human (Homo sapiens) [TaxId: 9606]}
glgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaelgaersglrv
vrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsdstqvnny
walnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaardmlfqv
laleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvsaqklls
llekdefksgahvdfyd

SCOPe Domain Coordinates for d4j7xj_:

Click to download the PDB-style file with coordinates for d4j7xj_.
(The format of our PDB-style files is described here.)

Timeline for d4j7xj_: