SCOP 1.67: Domain d1qvca_: 1qvc A:

Lineage for d1qvca_ (1qvc A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.40: OB-fold [50198] (10 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (10 proteins)
   barrel, closed; n=5, S=10

6. Protein ssDNA-binding protein [50264] (3 species)

7. Species Escherichia coli [TaxId:562] [50266] (4 PDB entries)

8. Domain d1qvca_: 1qvc A: [25284]

Details for d1qvca_

PDB Entry: 1qvc, 2.2 Å

PDB Description: crystal structure analysis of single stranded dna binding protein (ssb) from e.coli

SCOP Domain Sequences for d1qvca_:

Sequence; same for both SEQRES and ATOM records:

>d1qvca_ b.40.4.3 (A:) ssDNA-binding protein {Escherichia coli}
asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggrqggga
paggnigggqpqggwgqpqqpqggn

Timeline for d1qvca_:

• d1qvca_ first appeared (with stable ids) in SCOP 1.55
  
• d1qvca_ appears in SCOP 1.65
  
• d1qvca_ appears in SCOP 1.69
  
• d1qvca_ appears in the current release, SCOPe 2.08