Lineage for d1qvca_ (1qvc A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.40: OB-fold [50198] (7 superfamilies) Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) 
Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (6 proteins) Protein ssDNA-binding protein [50264] (2 species) 
Species Escherichia coli [TaxId:562] [50266] (3 PDB entries) 
Domain d1qvca_: 1qvc A: [25284]
Details for d1qvca_
PDB Entry: 1qvc (more details), 2.2 Å
PDB Description: crystal structure analysis of single stranded dna binding protein (ssb) from e.coli
SCOP Domain Sequences for d1qvca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qvca_ b.40.4.3 (A:) ssDNA-binding protein {Escherichia coli}
asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggrqggga
paggnigggqpqggwgqpqqpqggn
SCOP Domain Coordinates for d1qvca_:
Click to download the PDB-style file with coordinates for d1qvca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qvca_:
- d1qvca_ appears in SCOP 1.57
- d1qvca_ appears in the current release, SCOPe 2.08
View in 3D
