Lineage for d4j6ua_ (4j6u A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002034Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
    multihelical
  4. 2002035Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families) (S)
    duplication: contains two structural repeats
  5. 2002102Family a.86.1.0: automated matches [254307] (1 protein)
    not a true family
  6. 2002103Protein automated matches [254708] (2 species)
    not a true protein
  7. 2002104Species Bacillus megaterium [TaxId:1404] [255981] (18 PDB entries)
  8. 2002131Domain d4j6ua_: 4j6u A: [252829]
    automated match to d2ahka_
    mutant

Details for d4j6ua_

PDB Entry: 4j6u (more details), 2.5 Å

PDB Description: Crystal Structure of Tyrosinase from Bacillus megaterium N205A mutant
PDB Compounds: (A:) tyrosinase

SCOPe Domain Sequences for d4j6ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j6ua_ a.86.1.0 (A:) automated matches {Bacillus megaterium [TaxId: 1404]}
kyrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaahmss
aflpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnpikd
fivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtppwd
mtsqnsfrnqlegfingpqlharvhrwvggqmgvvptapndpvfflhhanvdriwavwqi
ihrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydie

SCOPe Domain Coordinates for d4j6ua_:

Click to download the PDB-style file with coordinates for d4j6ua_.
(The format of our PDB-style files is described here.)

Timeline for d4j6ua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4j6ub_