Lineage for d4j6lh_ (4j6l H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3001355Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 3001458Protein Low affinity immunoglobulin epsilon Fc receptor [143957] (1 species)
  7. 3001459Species Human (Homo sapiens) [TaxId:9606] [143958] (14 PDB entries)
    Uniprot P06734 156-298
  8. 3001510Domain d4j6lh_: 4j6l H: [252826]
    automated match to d1t8ca1

Details for d4j6lh_

PDB Entry: 4j6l (more details), 3.15 Å

PDB Description: crystal structure of calcium2+-free wild-type cd23 lectin domain (crystal form c)
PDB Compounds: (H:) Low affinity immunoglobulin epsilon Fc receptor

SCOPe Domain Sequences for d4j6lh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j6lh_ d.169.1.1 (H:) Low affinity immunoglobulin epsilon Fc receptor {Human (Homo sapiens) [TaxId: 9606]}
cntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhashtgs
wiglrnldlkgefiwvdgshvdysnwapgeptsrsqgedcvmmrgsgrwndafcdrklga
wvcdrlatc

SCOPe Domain Coordinates for d4j6lh_:

Click to download the PDB-style file with coordinates for d4j6lh_.
(The format of our PDB-style files is described here.)

Timeline for d4j6lh_: