Lineage for d3ulla_ (3ull A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 799407Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) (S)
  5. 799474Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (12 proteins)
    barrel, closed; n=5, S=10
  6. 799579Protein ssDNA-binding protein [50264] (4 species)
  7. 799603Species Human (Homo sapiens), mitochondria [TaxId:9606] [50265] (3 PDB entries)
    Uniprot Q04837
  8. 799604Domain d3ulla_: 3ull A: [25282]

Details for d3ulla_

PDB Entry: 3ull (more details), 2.4 Å

PDB Description: human mitochondrial single-stranded dna binding protein
PDB Compounds: (A:) DNA binding protein

SCOP Domain Sequences for d3ulla_:

Sequence, based on SEQRES records: (download)

>d3ulla_ b.40.4.3 (A:) ssDNA-binding protein {Human (Homo sapiens), mitochondria [TaxId: 9606]}
lerslnrvhllgrvgqdpvlrqvegknpvtifslatnemwrsgdsevyqlgdvsqkttwh
risvfrpglrdvayqyvkkgsriylegkidygeymdknnvrrqattiiadniifl

Sequence, based on observed residues (ATOM records): (download)

>d3ulla_ b.40.4.3 (A:) ssDNA-binding protein {Human (Homo sapiens), mitochondria [TaxId: 9606]}
lerslnrvhllgrvgqdpvlrqvegknpvtifslatnemwrsdvsqkttwhrisvfrpgl
rdvayqyvkkgsriylegkidygeymdknnvrrqattiiadniifl

SCOP Domain Coordinates for d3ulla_:

Click to download the PDB-style file with coordinates for d3ulla_.
(The format of our PDB-style files is described here.)

Timeline for d3ulla_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3ullb_