SCOPe 2.08: Domain d4j6ia3: 4j6i A:525-725

Lineage for d4j6ia3 (4j6i A:525-725)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (28 families)

5. Family a.118.1.0: automated matches [191340] (1 protein)
   not a true family

6. Protein automated matches [190220] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189070] (63 PDB entries)

8. Domain d4j6ia3: 4j6i A:525-725 [252817]
   Other proteins in same PDB: d4j6ia1, d4j6ia2, d4j6ia4, d4j6ia5
   automated match to d1e7ua1
   complexed with 1jv

Details for d4j6ia3

PDB Entry: 4j6i, 2.9 Å

PDB Description: Discovery of thiazolobenzoxepin PI3-kinase inhibitors that spare the PI3-kinase beta isoform

PDB Compounds: (A:) Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d4j6ia3:

Sequence, based on SEQRES records:

>d4j6ia3 a.118.1.0 (A:525-725) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hpialpkhqptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk
hpkaypklfssvkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraia
vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia
qsrhyqqrfavileaylrgcg

Sequence, based on observed residues (ATOM records):

>d4j6ia3 a.118.1.0 (A:525-725) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hpiaempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqq
eivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyll
qlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileayl
rgcg

Timeline for d4j6ia3:

• d4j6ia3 first appeared in SCOPe 2.04
  
• d4j6ia3 appears in SCOPe 2.07