| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.11: Arrestin/Vps26-like [81291] (2 proteins) |
| Protein automated matches [227018] (1 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [225765] (5 PDB entries) |
| Domain d4j2qb2: 4j2q B:183-360 [252811] automated match to d1ayra2 |
PDB Entry: 4j2q (more details), 3 Å
SCOPe Domain Sequences for d4j2qb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j2qb2 b.1.18.11 (B:183-360) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dmgpqpraeaswqffmsdkplrlavslskeiyyhgepipvtvavtnstektvkkikvlve
qvtnvvlyssdyyiktvaaeeaqekvppnssltktltlvpllannrerrgialdgkikhe
dtnlasstiikegidktvmgilvsyqikvkltvsgllgeltssevatevpfrlmhpqp
Timeline for d4j2qb2: