SCOPe 2.08: Domain d4j2qa2: 4j2q A:183-360

Lineage for d4j2qa2 (4j2q A:183-360)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.11: Arrestin/Vps26-like [81291] (2 proteins)

6. Protein automated matches [227018] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [225765] (5 PDB entries)

8. Domain d4j2qa2: 4j2q A:183-360 [252809]
   automated match to d1ayra2

Details for d4j2qa2

PDB Entry: 4j2q, 3 Å

PDB Description: Crystal structure of C-terminally truncated arrestin reveals mechanism of arrestin activation

PDB Compounds: (A:) S-arrestin

SCOPe Domain Sequences for d4j2qa2:

Sequence, based on SEQRES records:

>d4j2qa2 b.1.18.11 (A:183-360) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dmgpqpraeaswqffmsdkplrlavslskeiyyhgepipvtvavtnstektvkkikvlve
qvtnvvlyssdyyiktvaaeeaqekvppnssltktltlvpllannrerrgialdgkikhe
dtnlasstiikegidktvmgilvsyqikvkltvsgllgeltssevatevpfrlmhpqp

Sequence, based on observed residues (ATOM records):

>d4j2qa2 b.1.18.11 (A:183-360) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dmgpqpraeaswqffmsdkplrlavslskeiyyhgepipvtvavtnstektvkkikvlve
qvtnvvlyssdyyiktvaaeeaqekvppnssltktltlvpllannrerrgialdgkikhe
dtnlasstiikegidktvmgilvsyqikvkltvsglltssevatevpfrlmhpqp

Timeline for d4j2qa2:

• d4j2qa2 first appeared in SCOPe 2.04
  
• d4j2qa2 appears in SCOPe 2.07