Lineage for d4j1ob2 (4j1o B:127-369)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1823470Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1823858Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 1823859Protein automated matches [226923] (71 species)
    not a true protein
  7. 1824250Species Paracoccus denitrificans [TaxId:318586] [234379] (3 PDB entries)
  8. 1824252Domain d4j1ob2: 4j1o B:127-369 [252801]
    Other proteins in same PDB: d4j1oa1, d4j1ob1
    automated match to d4e8ga2
    complexed with gol, iod, mg, pbe

Details for d4j1ob2

PDB Entry: 4j1o (more details), 1.6 Å

PDB Description: crystal structure of an enolase (mandelate racemase subgroup) from paracococus denitrificans pd1222 (target nysgrc-012907) with bound l- proline betaine (substrate)
PDB Compounds: (B:) Mandelate racemase/muconate lactonizing enzyme, N-terminal domain protein

SCOPe Domain Sequences for d4j1ob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j1ob2 c.1.11.0 (B:127-369) automated matches {Paracoccus denitrificans [TaxId: 318586]}
vaaervpsyyatgigqpdeiariaaekvaegfprlqikiggrpveidietvrkvwerirg
tgtrlavdgnrslpsrdalrlsrecpeipfvleqpcntleeiaairgrvqhgiyldesge
dlstviraagqglcdgfgmkltrigglqqmaafrdicearalphscddawggdiiaaact
higatvqprlnegvwvaqpyiaqpydeengiriagghidlpkgpglgitpdeslfgppva
sfs

SCOPe Domain Coordinates for d4j1ob2:

Click to download the PDB-style file with coordinates for d4j1ob2.
(The format of our PDB-style files is described here.)

Timeline for d4j1ob2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4j1ob1