| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
| Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
| Protein automated matches [190360] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188758] (10 PDB entries) |
| Domain d4j19b_: 4j19 B: [252797] automated match to d2cufa1 protein/DNA complex; complexed with cl |
PDB Entry: 4j19 (more details), 2.9 Å
SCOPe Domain Sequences for d4j19b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j19b_ a.4.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrgsrftwrkeclavmesyfnenqypdeakreeianacnaviqkpgkklsdlervtslkv
ynwfanrrkeikrran
Timeline for d4j19b_: