![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
![]() | Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
![]() | Protein automated matches [190360] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188758] (7 PDB entries) |
![]() | Domain d4j19a_: 4j19 A: [252796] automated match to d2cufa1 protein/DNA complex; complexed with cl |
PDB Entry: 4j19 (more details), 2.9 Å
SCOPe Domain Sequences for d4j19a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j19a_ a.4.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gsrftwrkeclavmesyfnenqypdeakreeianacnaviqkpgkklsdlervtslkvyn wfanrrkeikrraniea
Timeline for d4j19a_: