SCOPe 2.08: Domain d4j19a_: 4j19 A:

Lineage for d4j19a_ (4j19 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (41 proteins)
   Pfam PF00046

6. Protein automated matches [190360] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188758] (10 PDB entries)

8. Domain d4j19a_: 4j19 A: [252796]
   automated match to d2cufa1
   protein/DNA complex; complexed with cl

Details for d4j19a_

PDB Entry: 4j19, 2.9 Å

PDB Description: structure of a novel telomere repeat binding protein bound to dna

PDB Compounds: (A:) Homeobox-containing protein 1

SCOPe Domain Sequences for d4j19a_:

Sequence; same for both SEQRES and ATOM records:

>d4j19a_ a.4.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsrftwrkeclavmesyfnenqypdeakreeianacnaviqkpgkklsdlervtslkvyn
wfanrrkeikrraniea

Timeline for d4j19a_:

• d4j19a_ first appeared in SCOPe 2.04
  
• d4j19a_ appears in SCOPe 2.07