Lineage for d4j0qd1 (4j0q D:9-205)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1849617Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1849618Protein automated matches [190123] (96 species)
    not a true protein
  7. 1850279Species Pseudomonas putida [TaxId:160488] [256311] (2 PDB entries)
  8. 1850283Domain d4j0qd1: 4j0q D:9-205 [252790]
    Other proteins in same PDB: d4j0qa2, d4j0qa3, d4j0qb2, d4j0qb3, d4j0qc2, d4j0qc3, d4j0qd2, d4j0qd3, d4j0qe2, d4j0qe3
    automated match to d1b23p3
    complexed with gdp, mes, mg, mpd

Details for d4j0qd1

PDB Entry: 4j0q (more details), 2.29 Å

PDB Description: crystal structure of pseudomonas putida elongation factor tu (ef-tu)
PDB Compounds: (D:) elongation factor tu-a

SCOPe Domain Sequences for d4j0qd1:

Sequence, based on SEQRES records: (download)

>d4j0qd1 c.37.1.0 (D:9-205) automated matches {Pseudomonas putida [TaxId: 160488]}
slphvnvgtighvdhgkttltaaltrvcsevfgsaivefdkidsapeekargitintahv
eynstirhyahvdcpghadyvknmitgaaqmdgailvcsaadgpmpqtrehillsrqvgv
pyivvflnkadlvddaellelvemevrdllstydfpgddtpiiigsarmalegkddnemg
ttavkklvetldsyipe

Sequence, based on observed residues (ATOM records): (download)

>d4j0qd1 c.37.1.0 (D:9-205) automated matches {Pseudomonas putida [TaxId: 160488]}
slphvnvgtighvdhgkttltaaltrvcsevfgsitintahveynstirhyahvdcpgha
dyvknmitgaaqmdgailvcsaadgpmpqtrehillsrqvgvpyivvflnkadlvddael
lelvemevrdllstydfpgddtpiiigsarmalegkddnemgttavkklvetldsyipe

SCOPe Domain Coordinates for d4j0qd1:

Click to download the PDB-style file with coordinates for d4j0qd1.
(The format of our PDB-style files is described here.)

Timeline for d4j0qd1: