Class b: All beta proteins [48724] (176 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
Protein automated matches [226946] (19 species) not a true protein |
Species Pseudomonas putida [TaxId:160488] [256312] (2 PDB entries) |
Domain d4j0qa2: 4j0q A:206-304 [252782] Other proteins in same PDB: d4j0qa1, d4j0qa3, d4j0qb1, d4j0qb3, d4j0qc1, d4j0qc3, d4j0qd1, d4j0qd3, d4j0qe1, d4j0qe3 automated match to d1b23p1 complexed with gdp, mes, mg, mpd |
PDB Entry: 4j0q (more details), 2.29 Å
SCOPe Domain Sequences for d4j0qa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j0qa2 b.43.3.0 (A:206-304) automated matches {Pseudomonas putida [TaxId: 160488]} pvraidqpflmpiedvfsisgrgtvvtgriergivrvqdpleivglrdtttttctgvemf rklldegragencgvllrgtkrddvergqvlvkpgsvkp
Timeline for d4j0qa2: