| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
| Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
| Protein automated matches [226851] (46 species) not a true protein |
| Species Nematode (Caenorhabditis elegans) [TaxId:6239] [237814] (2 PDB entries) |
| Domain d4j0fb2: 4j0f B:199-296 [252780] Other proteins in same PDB: d4j0fa1, d4j0fb1 automated match to d4j0eb2 |
PDB Entry: 4j0f (more details), 2.2 Å
SCOPe Domain Sequences for d4j0fb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j0fb2 a.100.1.0 (B:199-296) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
gfivnrllipyffeaarmyergdasmtdideamklgaghpmgpfeladyigldtvkfvmd
gwaakypevqlfeasplvdklvaegklgrktgdgfysy
Timeline for d4j0fb2: