Lineage for d1bvse3 (1bvs E:1-63)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2398945Family b.40.4.2: DNA helicase RuvA subunit, N-terminal domain [50259] (1 protein)
    barrel, closed; n=5, S=10
    automatically mapped to Pfam PF01330
  6. 2398946Protein DNA helicase RuvA subunit, N-terminal domain [50260] (3 species)
    tetramer; binds Holliday junction
  7. 2398957Species Mycobacterium leprae [TaxId:1769] [50262] (1 PDB entry)
  8. 2398962Domain d1bvse3: 1bvs E:1-63 [25278]
    Other proteins in same PDB: d1bvsa1, d1bvsa2, d1bvsb1, d1bvsb2, d1bvsc1, d1bvsc2, d1bvsd1, d1bvsd2, d1bvse1, d1bvse2, d1bvsf1, d1bvsf2, d1bvsg1, d1bvsg2, d1bvsh1, d1bvsh2
    protein/DNA complex

Details for d1bvse3

PDB Entry: 1bvs (more details), 3 Å

PDB Description: ruva complexed to a holliday junction.
PDB Compounds: (E:) protein (holliday junction DNA helicase ruva)

SCOPe Domain Sequences for d1bvse3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvse3 b.40.4.2 (E:1-63) DNA helicase RuvA subunit, N-terminal domain {Mycobacterium leprae [TaxId: 1769]}
mifsvrgevlevaldhavieaagigyrvnatpsalatlnqgsqarlvtamvvredsmtly
gfs

SCOPe Domain Coordinates for d1bvse3:

Click to download the PDB-style file with coordinates for d1bvse3.
(The format of our PDB-style files is described here.)

Timeline for d1bvse3: