Lineage for d4j0fa2 (4j0f A:199-296)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721533Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2721534Protein automated matches [226851] (46 species)
    not a true protein
  7. 2721876Species Nematode (Caenorhabditis elegans) [TaxId:6239] [237814] (2 PDB entries)
  8. 2721879Domain d4j0fa2: 4j0f A:199-296 [252778]
    Other proteins in same PDB: d4j0fa1, d4j0fb1
    automated match to d4j0eb2

Details for d4j0fa2

PDB Entry: 4j0f (more details), 2.2 Å

PDB Description: Crystal structure of 3-hydroxyacyl-CoA dehydrogenase from Caenorhadbitis elegans in P212121 space group
PDB Compounds: (A:) Probable 3-hydroxyacyl-CoA dehydrogenase F54C8.1

SCOPe Domain Sequences for d4j0fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j0fa2 a.100.1.0 (A:199-296) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
gfivnrllipyffeaarmyergdasmtdideamklgaghpmgpfeladyigldtvkfvmd
gwaakypevqlfeasplvdklvaegklgrktgdgfysy

SCOPe Domain Coordinates for d4j0fa2:

Click to download the PDB-style file with coordinates for d4j0fa2.
(The format of our PDB-style files is described here.)

Timeline for d4j0fa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4j0fa1