Lineage for d4j0fa1 (4j0f A:9-198)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2108268Species Nematode (Caenorhabditis elegans) [TaxId:6239] [237812] (4 PDB entries)
  8. 2108275Domain d4j0fa1: 4j0f A:9-198 [252777]
    Other proteins in same PDB: d4j0fa2, d4j0fb2
    automated match to d4j0eb1

Details for d4j0fa1

PDB Entry: 4j0f (more details), 2.2 Å

PDB Description: Crystal structure of 3-hydroxyacyl-CoA dehydrogenase from Caenorhadbitis elegans in P212121 space group
PDB Compounds: (A:) Probable 3-hydroxyacyl-CoA dehydrogenase F54C8.1

SCOPe Domain Sequences for d4j0fa1:

Sequence, based on SEQRES records: (download)

>d4j0fa1 c.2.1.0 (A:9-198) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
qnirnvaivgsgqmgsgiaqvtassgfnvmladvnkkaldramkaisqsvthlskkqkgt
dkeksdfvtltmsriktcnnvstavadadliieaaienidlkrgifaqieqsckkdsilt
tntssflledvakglqdktrfgglhffnpvpvmkllevirsddtsdetyatlikfgtavg
kttvackdsp

Sequence, based on observed residues (ATOM records): (download)

>d4j0fa1 c.2.1.0 (A:9-198) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
qnirnvaivgsgqmgsgiaqvtassgfnvmladvnkkaldramkaisqsvthlskkqgtd
keksdfvtltmsriktcnnvstavadadliieaaienidlkrgifaqieqsckkdsiltt
ntssflledvakglqdktrfgglhffnpvpvmkllevirsddtsdetyatlikfgtavgk
ttvackdsp

SCOPe Domain Coordinates for d4j0fa1:

Click to download the PDB-style file with coordinates for d4j0fa1.
(The format of our PDB-style files is described here.)

Timeline for d4j0fa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4j0fa2