Lineage for d4j07e_ (4j07 E:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2462833Fold c.16: Lumazine synthase [52120] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2462834Superfamily c.16.1: Lumazine synthase [52121] (2 families) (S)
  5. 2463065Family c.16.1.0: automated matches [254329] (1 protein)
    not a true family
  6. 2463066Protein automated matches [254751] (1 species)
    not a true protein
  7. 2463067Species Mycobacterium leprae [TaxId:561304] [256316] (1 PDB entry)
  8. 2463072Domain d4j07e_: 4j07 E: [252776]
    automated match to d1nqua_
    complexed with na, so4

Details for d4j07e_

PDB Entry: 4j07 (more details), 1.95 Å

PDB Description: crystal structure of a probable riboflavin synthase, beta chain ribh (6,7-dimethyl-8-ribityllumazine synthase, dmrl synthase, lumazine synthase) from mycobacterium leprae
PDB Compounds: (E:) 6,7-dimethyl-8-ribityllumazine synthase

SCOPe Domain Sequences for d4j07e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j07e_ c.16.1.0 (E:) automated matches {Mycobacterium leprae [TaxId: 561304]}
idasglrlgivastwhsricdallagarkvaadsgidgptvvrvlgaieipvvvqelarh
hdavvalgvvirgdtphfdyvcnsvtqgltrialdtstpvgngvlttntekqaldraglp
tsaedkgaqaaaaalttaltllnlrsri

SCOPe Domain Coordinates for d4j07e_:

Click to download the PDB-style file with coordinates for d4j07e_.
(The format of our PDB-style files is described here.)

Timeline for d4j07e_: