![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.16: Lumazine synthase [52120] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.16.1: Lumazine synthase [52121] (2 families) ![]() |
![]() | Family c.16.1.0: automated matches [254329] (1 protein) not a true family |
![]() | Protein automated matches [254751] (1 species) not a true protein |
![]() | Species Mycobacterium leprae [TaxId:561304] [256316] (1 PDB entry) |
![]() | Domain d4j07e_: 4j07 E: [252776] automated match to d1nqua_ complexed with na, so4 |
PDB Entry: 4j07 (more details), 1.95 Å
SCOPe Domain Sequences for d4j07e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j07e_ c.16.1.0 (E:) automated matches {Mycobacterium leprae [TaxId: 561304]} idasglrlgivastwhsricdallagarkvaadsgidgptvvrvlgaieipvvvqelarh hdavvalgvvirgdtphfdyvcnsvtqgltrialdtstpvgngvlttntekqaldraglp tsaedkgaqaaaaalttaltllnlrsri
Timeline for d4j07e_:
![]() Domains from other chains: (mouse over for more information) d4j07a_, d4j07b_, d4j07c_, d4j07d_ |