SCOPe 2.06: Domain d4j07b_: 4j07 B:

Lineage for d4j07b_ (4j07 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.16: Lumazine synthase [52120] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.16.1: Lumazine synthase [52121] (2 families)

5. Family c.16.1.0: automated matches [254329] (1 protein)
   not a true family

6. Protein automated matches [254751] (1 species)
   not a true protein

7. Species Mycobacterium leprae [TaxId:561304] [256316] (1 PDB entry)

8. Domain d4j07b_: 4j07 B: [252773]
   automated match to d1nqua_
   complexed with na, so4

Details for d4j07b_

PDB Entry: 4j07, 1.95 Å

PDB Description: crystal structure of a probable riboflavin synthase, beta chain ribh (6,7-dimethyl-8-ribityllumazine synthase, dmrl synthase, lumazine synthase) from mycobacterium leprae

PDB Compounds: (B:) 6,7-dimethyl-8-ribityllumazine synthase

SCOPe Domain Sequences for d4j07b_:

Sequence; same for both SEQRES and ATOM records:

>d4j07b_ c.16.1.0 (B:) automated matches {Mycobacterium leprae [TaxId: 561304]}
gidasglrlgivastwhsricdallagarkvaadsgidgptvvrvlgaieipvvvqelar
hhdavvalgvvirgdtphfdyvcnsvtqgltrialdtstpvgngvlttntekqaldragl
ptsaedkgaqaaaaalttaltllnlrsr

Timeline for d4j07b_:

• d4j07b_ first appeared in SCOPe 2.04
  
• d4j07b_ appears in SCOPe 2.05
  
• d4j07b_ appears in SCOPe 2.07
  
• d4j07b_ appears in the current release, SCOPe 2.08