SCOPe 2.08: Domain d4izga1: 4izg A:1-126

Lineage for d4izga1 (4izg A:1-126)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Paracoccus denitrificans [TaxId:318586] [234364] (3 PDB entries)

8. Domain d4izga1: 4izg A:1-126 [252768]
   Other proteins in same PDB: d4izga2, d4izgb2
   automated match to d4e8ga1
   complexed with 4op, iod, mg

Details for d4izga1

PDB Entry: 4izg, 1.7 Å

PDB Description: crystal structure of an enolase (mandelate racemase subgroup) from paracococus denitrificans pd1222 (target nysgrc-012907) with bound cis-4oh-d-proline betaine (product)

PDB Compounds: (A:) Mandelate racemase/muconate lactonizing enzyme, N-terminal domain protein

SCOPe Domain Sequences for d4izga1:

Sequence; same for both SEQRES and ATOM records:

>d4izga1 d.54.1.0 (A:1-126) automated matches {Paracoccus denitrificans [TaxId: 318586]}
mkiaeihvyahdlpvkdgpytiasstvwslqttlvkivadsglagwgetcpvgptyapsh
algaraalaemapgliganplqplvlrrrmdgllcghnyakaaidiaaydlmgkhygvrv
adllgg

Timeline for d4izga1:

• d4izga1 first appeared in SCOPe 2.04
  
• d4izga1 appears in SCOPe 2.07