Lineage for d4izga1 (4izg A:1-126)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948416Species Paracoccus denitrificans [TaxId:318586] [234364] (3 PDB entries)
  8. 2948419Domain d4izga1: 4izg A:1-126 [252768]
    Other proteins in same PDB: d4izga2, d4izgb2
    automated match to d4e8ga1
    complexed with 4op, iod, mg

Details for d4izga1

PDB Entry: 4izg (more details), 1.7 Å

PDB Description: crystal structure of an enolase (mandelate racemase subgroup) from paracococus denitrificans pd1222 (target nysgrc-012907) with bound cis-4oh-d-proline betaine (product)
PDB Compounds: (A:) Mandelate racemase/muconate lactonizing enzyme, N-terminal domain protein

SCOPe Domain Sequences for d4izga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4izga1 d.54.1.0 (A:1-126) automated matches {Paracoccus denitrificans [TaxId: 318586]}
mkiaeihvyahdlpvkdgpytiasstvwslqttlvkivadsglagwgetcpvgptyapsh
algaraalaemapgliganplqplvlrrrmdgllcghnyakaaidiaaydlmgkhygvrv
adllgg

SCOPe Domain Coordinates for d4izga1:

Click to download the PDB-style file with coordinates for d4izga1.
(The format of our PDB-style files is described here.)

Timeline for d4izga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4izga2